PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK32783.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family GRF
Protein Properties Length: 515aa    MW: 55481.6 Da    PI: 9.3829
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK32783.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.37.3e-25189233145
         WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                 d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  KFK32783.1 189 DPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKPVEG 233
                 79****************************************985 PP

2QLQ49.91e-17125161137
         QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                 ++F+ +Q+++L++Q+l+yKy+ an PvP+ Ll+ ++k
  KFK32783.1 125 GPFSLTQWAELEQQALIYKYITANIPVPSSLLLSLKK 161
                 59******************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.0E-10125161IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.325126161IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.2E-12126158IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.954189233IPR014977WRC domain
PfamPF088793.3E-21190232IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MDLGVRVQGS VSGHENGSPG QPELGSSLSS KQERYGFDGE DCWRSSKVAR TTPETMSFHQ  60
GIPLLRSTSI LSSDPRNRQE HMLSFSSDKS DVSPYLQYCK NSGYGLGGMM NTSSMHGNLL  120
TGVKGPFSLT QWAELEQQAL IYKYITANIP VPSSLLLSLK KSFFPYGSLP PNSFGWGSFH  180
LGFSGGNMDP EPGRCRRTDG KKWRCSRDAV PDQKYCERHI NRGRHRSRKP VEGQNGHNTT  240
NAAAAASTAA SKAVATTVVA MRGSDNNNSL ASVGNHHLHA NPSTDSLANR VQISRGGSVY  300
PASMNLQLKE SHPKQSNNPF EFGLISSDSL LNPSHKQASY ANSSKGFGSY LDFSNQAKHS  360
GNHHNVDSWP EELKSDWTQL SMSIPMAPSS PVQDKLALSP LRLSREFDPA IHMGLGVNTE  420
FLEPAKKVNN WIPISWGNHN SMGGPLGEVL NSTTNSPKFG SSPTGVLQKS TFGSLSNSSS  480
GSSTVVGENN HKNGDGKDPL GPTTLMNSSA TAPSL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006404750.10.0hypothetical protein EUTSA_v10000124mg
SwissprotO810010.0GRF1_ARATH; Growth-regulating factor 1
TrEMBLA0A087GSD10.0A0A087GSD1_ARAAL; Uncharacterized protein
STRINGAT2G22840.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14542886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.10.0growth-regulating factor 1